<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12827
| Description |
cyclin-C |
| Sequence | MGLQEGLGIWGQGKERQGLPLNSGSLQWILDKQDLLKERQKDLKFLAEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILNKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
| Length | 198 |
| Position | Kinase |
| Organism | Alligator sinensis (Chinese alligator) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.182 |
| Instability index | 47.13 |
| Isoelectric point | 6.90 |
| Molecular weight | 34554.87 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12827
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.21| 18| 22| 14| 31| 1
---------------------------------------------------------------------------
14- 31 (32.54/19.16) KERQ.GLPLNSGSLQWILD
37- 55 (27.67/15.39) KERQkDLKFLAEEEYWKLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 229| 242| 2
---------------------------------------------------------------------------
229- 242 (20.63/15.62) QW..FAELSvDMEKIL
254- 268 (20.73/10.99) QWknFDERK.EMATIL
---------------------------------------------------------------------------
|