<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12815
| Description |
mediator of RNA polymerase II transcription subunit 25-like |
| Sequence | MQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGF |
| Length | 84 |
| Position | Unknown |
| Organism | Mesocricetus auratus (Golden hamster) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Mesocricetus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.089 |
| Instability index | 20.99 |
| Isoelectric point | 9.62 |
| Molecular weight | 9622.33 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12815
No repeats found
|