<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12794

Description F-box-like/WD repeat-containing protein TBL1X isoform X2
SequenceMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQANAAAAAAAAAAATAATTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLSCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length528
PositionTail
OrganismMesocricetus auratus (Golden hamster)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Cricetidae> Cricetinae> Mesocricetus.
Aromaticity0.07
Grand average of hydropathy-0.267
Instability index39.02
Isoelectric point5.40
Molecular weight56876.71
Publications









Function






Annotated function


GO - Cellular Component
transcription regulator complex	GO:0005667	IEA:Ensembl

GO - Biological Function
chromatin binding	GO:0003682	IEA:Ensembl
transcription corepressor activity	GO:0003714	IEA:Ensembl
transcription regulatory region sequence-specific DNA binding	GO:0000976	IEA:Ensembl

GO - Biological Process
fat cell differentiation	GO:0045444	IEA:Ensembl
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:Ensembl
proteasome-mediated ubiquitin-dependent protein catabolic process	GO:0043161	IEA:Ensembl
protein stabilization	GO:0050821	IEA:Ensembl
response to estrogen	GO:0043627	IEA:Ensembl
response to steroid hormone	GO:0048545	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12794
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     395.45|      40|      40|     336|     375|       1
---------------------------------------------------------------------------
  179-  208 (33.71/15.12)	............LRGHESEVFICAWNPVS.........dlL.A.SGS.GDSTAR
  227-  264 (47.70/24.27)	HCIREGGHDVPS....NKDVTSLDWNSDG.........tlL.A.TGS.YDGFAR
  265-  305 (46.80/23.68)	I.WTEDGNLASTLGQHKGPIFALKWNKKG..........nY.IlSAG.VDKTTI
  306-  346 (53.78/28.24)	IWDAHTGEAKQQFPFHSAPALDVDWQNN..........ttF.A.SCS.TDMCIH
  347-  388 (59.80/32.18)	VCRLSCDRPVKTFQGHTNEVNAIKWDPSG.........mlL.A.SCS.DDMTLK
  389-  439 (57.40/30.61)	IWSMKQDACVHDLQAHSKEIYTIKWSPTGpatsnpnsnimL.A.SAS.FDSTVR
  443-  481 (50.13/25.86)	VERGVC...IHTLTKHQEPVYSVAFSPDG..........kYlA.SGS.FDKCVH
  482-  523 (46.13/23.24)	IWNTQSGSLVHSYRG.TGGIFEVCWNARG........dkvG.A.SASdGSVCV.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12794 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPSSKA
124
176










Molecular Recognition Features






MoRF SequenceStartStop




1) FLVYRY
10
15