<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12777
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDSQVKLAIVVKVMGRTGSRGQVTQGKYEVMAATSATYPPPPPYYRLYKDYLQNPKLASEPPPPIQGTYMLYGGTYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIRRRREEAQRLLKESLGTLDGH |
| Length | 200 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.584 |
| Instability index | 63.64 |
| Isoelectric point | 9.46 |
| Molecular weight | 23008.19 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
ribosome GO:0005840 IEA:InterPro
|
| GO - Biological Function | structural constituent of ribosome GO:0003735 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
translation GO:0006412 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12777
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.90| 13| 21| 36| 48| 1
---------------------------------------------------------------------------
36- 48 (30.61/13.65) ATYPPPP..PYYRLY
58- 72 (24.28/ 9.71) ASEPPPPiqGTYMLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.74| 38| 45| 106| 144| 2
---------------------------------------------------------------------------
80- 110 (27.78/13.61) ...........DVLPSLEEQGVRQLypKGPNIDFKKeLRSLN
111- 150 (57.27/39.49) RELQLHILELaDVLVERPSQYARRV..EDISLIFKNlHHLLN
158- 179 (27.69/13.83) RATLIHILEL.QI..QRRKQ...AV..EDI............
---------------------------------------------------------------------------
|