<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12776
Description |
mediator of RNA polymerase II transcription subunit 19a-like |
Sequence | MSLMDPEVKRFGRGRKELTGAADLINHYKLWAHHEFFCKRSLPLSISDTCYLHNVVGDTEIRKGEGMELDQLFQNTLYARNTNAHIQPFDLDTLREAFLLRETAPIDLPSAEKGIPTIAGKSRSVSKDEEKKHKKHKDKNKDKDKERKKHKHHHRDKSKEKDKEKKKDKNGQHDSGAEHSKKHHEKKRKYDGSEDLTDIHKHKKSKHRSSKFNEIGAIKVVG |
Length | 222 |
Position | Head |
Organism | Nelumbo nucifera (Sacred lotus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.341 |
Instability index | 40.14 |
Isoelectric point | 9.61 |
Molecular weight | 25779.89 |
Publications | PubMed=23663246
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12776
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.73| 15| 15| 130| 144| 1
---------------------------------------------------------------------------
130- 144 (29.53/ 9.35) EKKHK.KHKDKNKDKD
147- 162 (23.20/ 6.05) RKKHKhHHRDKSKEKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.70| 12| 15| 183| 194| 2
---------------------------------------------------------------------------
183- 194 (22.49/10.70) HHEKKRKYDGSE
200- 211 (21.21/ 9.69) HKHKKSKHRSSK
---------------------------------------------------------------------------
|