<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12769
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDSQVKLAIVVKVMGRTGSRGQVTQGKYEVMAATSATYPPPPPYYRLYKDYLQNPKLASEPPPPIQGTYMLYGGTYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIRRREEAQRLLKESLGTLDGH |
| Length | 199 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.564 |
| Instability index | 61.03 |
| Isoelectric point | 9.34 |
| Molecular weight | 22852.01 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
ribosome GO:0005840 IEA:InterPro
|
| GO - Biological Function | structural constituent of ribosome GO:0003735 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
translation GO:0006412 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12769
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.90| 13| 21| 36| 48| 1
---------------------------------------------------------------------------
36- 48 (30.61/16.12) ATYPPPP..PYYRLY
58- 72 (24.28/11.55) ASEPPPPiqGTYMLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.01| 36| 44| 106| 149| 2
---------------------------------------------------------------------------
106- 144 (54.91/54.37) LRSLN.RELQLHILELAdvlVERPSQYA...RRVEDISLIFKN
152- 191 (51.11/30.08) LRPHQaRATLIHILELQ...IQRRKQAVediRRREEAQRLLKE
---------------------------------------------------------------------------
|