<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12767
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDSQVKLAIVVKGKYEVMAATSATYPPPPPYYRLYKDYLQNPKLASEPPPPIQGTYMLYGGTYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIRRRREEAQRLLKESLGTLDGH |
| Length | 187 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.576 |
| Instability index | 68.51 |
| Isoelectric point | 9.20 |
| Molecular weight | 21649.67 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12767
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.90| 13| 21| 23| 35| 1
---------------------------------------------------------------------------
23- 35 (30.61/14.40) ATYPPPP..PYYRLY
45- 59 (24.28/10.25) ASEPPPPiqGTYMLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.74| 38| 45| 93| 131| 2
---------------------------------------------------------------------------
67- 97 (27.78/14.58) ...........DVLPSLEEQGVRQLypKGPNIDFKKeLRSLN
98- 137 (57.27/42.06) RELQLHILELaDVLVERPSQYARRV..EDISLIFKNlHHLLN
145- 166 (27.69/14.82) RATLIHILEL.QI..QRRKQ...AV..EDI............
---------------------------------------------------------------------------
|