<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12766

Description probable mediator of RNA polymerase II transcription subunit 36b
SequenceMRPPRGRGGGGFRGRSDGGRGRGRGGGGRGGDGGGRGRGGGRGGGRGGGRGRGGRGGGMKGGSRVVIEPHRHEGVFIAKGKEDALVTKNMVTGEAVYGEKRISVQNEDGSKVEYRVWNPFRSKLAAAILGGVDNIWIVPGARVLYLGGASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPARYRMLVGMVDVIFSDVAQPDQARILALNASYFLKNGGHFVISIKANCIDSTVPAEAVFVQEVKKLQADQFKPSEQVTLEPFERDHACVVGGYRMPKKQKTAA
Length303
PositionUnknown
OrganismNelumbo nucifera (Sacred lotus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
Aromaticity0.06
Grand average of hydropathy-0.406
Instability index33.60
Isoelectric point10.34
Molecular weight32116.18
Publications
PubMed=23663246

Function

Annotated function 
GO - Cellular Component
box C/D RNP complex	GO:0031428	IBA:GO_Central
Cajal body	GO:0015030	IBA:GO_Central
small-subunit processome	GO:0032040	IBA:GO_Central

GO - Biological Function
histone-glutamine methyltransferase activity	GO:1990259	IBA:GO_Central
RNA binding	GO:0003723	IBA:GO_Central
rRNA methyltransferase activity	GO:0008649	IBA:GO_Central

GO - Biological Process
box C/D RNA 3'-end processing	GO:0000494	IBA:GO_Central
histone glutamine methylation	GO:1990258	IBA:GO_Central
rRNA methylation	GO:0031167	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12766
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.02|      14|      15|      18|      31|       1
---------------------------------------------------------------------------
   18-   31 (35.25/10.91)	GGRGRGRG.GGGRGG
   34-   48 (29.77/ 8.13)	GGRGRGGGrGGGRGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.37|      12|      44|       5|      16|       2
---------------------------------------------------------------------------
    5-   16 (26.56/ 9.23)	RGRG..GGGFRGRS
   50-   63 (21.80/ 6.28)	RGRGgrGGGMKGGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.53|      14|      17|     193|     206|       3
---------------------------------------------------------------------------
  193-  206 (25.53/16.63)	IIEDARHPARYRML
  213-  226 (24.00/15.29)	IFSDVAQPDQARIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.09|      17|      17|     240|     256|       4
---------------------------------------------------------------------------
  240-  256 (29.13/19.35)	FVISIKANCIDSTVPAE
  259-  275 (28.96/19.21)	FVQEVKKLQADQFKPSE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12766 with Med36 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MRPPRGRGGGGFRGRSDGGRGRGRGGGGRGGDGGGRGRGGGRGGGRGGGRGRGGRGGGMKGGSRVV
1
66










Molecular Recognition Features






MoRF SequenceStartStop




1) MRPPRGRGGGGFRGRSDGGRGRGRGGGGRGGDGGGRGRGGGRGGGRGGGRGRGGR
1
55