| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MMSKLLQYLAQNRYFEDEAFIGYLKYLQYWQRPEYVKFIMYPHCLFFLELLQNSNFRNAMAHPGSKEIAHRQQFFFWKNYRNNRLKHILPRPLPEPVAAPPAPIPPPAPLPATNVPVAASPAPVLVPVPAPAAPPASALSPMPYGLPPGPTLSKNDPRNSGIDRRKRKKEG |
| Length | 171 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.440 |
| Instability index | 72.06 |
| Isoelectric point | 9.95 |
| Molecular weight | 19411.41 |
| Publications | PubMed=23663246 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP12755
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.94| 15| 18| 109| 123| 2
---------------------------------------------------------------------------
109- 123 (28.44/ 8.66) PLPATNVPVAASPAP
129- 143 (28.50/ 8.69) PAPAAPPASALSPMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.88| 15| 18| 6| 23| 3
---------------------------------------------------------------------------
6- 23 (24.11/19.12) LQYLAQNRYFEdeaFIGY
27- 41 (31.77/17.23) LQYWQRPEYVK...FIMY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.79| 9| 26| 45| 58| 4
---------------------------------------------------------------------------
45- 58 (11.90/22.38) LFFLEllqnsNFRN
74- 82 (20.89/16.28) FFFWK.....NYRN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) SGIDRRK 2) WKNYRNNRLKHIL | 160 77 | 166 89 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab