Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MMSKLLQYLAQNRYFEDEAFIGYLKYLQYWQRPEYVKFIMYPHCLFFLELLQNSNFRNAMAHPGSKEIAHRQQFFFWKNYRNNRLKHILPRPLPEPVAAPPAPIPPPAPLPATNVPVAASPAPVLVPVPAPAAPPASALSPMPYGLPPGPTLSKNDPRNSGIDRRKRKKEG |
Length | 171 |
Position | Middle |
Organism | Nelumbo nucifera (Sacred lotus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.440 |
Instability index | 72.06 |
Isoelectric point | 9.95 |
Molecular weight | 19411.41 |
Publications | PubMed=23663246 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP12755 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.94| 15| 18| 109| 123| 2 --------------------------------------------------------------------------- 109- 123 (28.44/ 8.66) PLPATNVPVAASPAP 129- 143 (28.50/ 8.69) PAPAAPPASALSPMP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.88| 15| 18| 6| 23| 3 --------------------------------------------------------------------------- 6- 23 (24.11/19.12) LQYLAQNRYFEdeaFIGY 27- 41 (31.77/17.23) LQYWQRPEYVK...FIMY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.79| 9| 26| 45| 58| 4 --------------------------------------------------------------------------- 45- 58 (11.90/22.38) LFFLEllqnsNFRN 74- 82 (20.89/16.28) FFFWK.....NYRN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SGIDRRK 2) WKNYRNNRLKHIL | 160 77 | 166 89 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab