<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12754
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASGKESDDVQTPSMPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYVKFIMYPHCLFFLELLQNSNFRNAMAHPGSKEIAHRQQFFFWKNYRNNRLKHILPRPLPEPVAAPPAPIPPPAPLPATNVPVAASPAPVLVPVPAPAAPPASALSPMPYGLPPGPTLSKNDPRNSGIDRRKRKKEG |
| Length | 211 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.537 |
| Instability index | 67.38 |
| Isoelectric point | 9.39 |
| Molecular weight | 23960.32 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP12754
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.50| 15| 18| 149| 163| 2
---------------------------------------------------------------------------
149- 163 (28.65/11.38) PLPATNVPVAASPAP
169- 183 (29.85/12.13) PAPAAPPASALSPMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.18| 16| 18| 60| 75| 3
---------------------------------------------------------------------------
30- 45 (28.00/16.21) FLLE...LEFVQCLANPTY
60- 75 (31.96/19.32) FIGY...LKYLQYWQRPEY
78- 96 (23.22/12.45) FIMYphcLFFLELLQNSNF
---------------------------------------------------------------------------
|