Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MLLLSSTRRRRTIVRKSFHRRPYPSRLSRNFGNSMDSQYQNTSLQRLHHVEKRIVRVLELAGSVTDELSNSTGPRMEILNNHCREFMQSIMNIQVTLREEIKSACEYRPFEKCDYSSRISNEICFKKLEYVIEQLDGMKQSIGQYYGAM |
Length | 149 |
Position | Head |
Organism | Nelumbo nucifera (Sacred lotus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.656 |
Instability index | 62.01 |
Isoelectric point | 9.57 |
Molecular weight | 17603.01 |
Publications | PubMed=23663246 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP12752 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MLLLS 2) VRKSFHRRPY | 1 14 | 5 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab