<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12749
| Description |
mediator of RNA polymerase II transcription subunit 9-like isoform X2 |
| Sequence | MDPYSGGSWMMIPSASNHNTSSITSNQEHSHLHQQYHHQLQPQQQQPQRHQQHHQHQSLASHFHLLHLVENLAEAIESGTREQHSDALVNELTSHFEKCQQLLNSISVSINTKAMTVDGQKRKLEESEQLLNQRSLIL |
| Length | 138 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.899 |
| Instability index | 51.29 |
| Isoelectric point | 6.28 |
| Molecular weight | 15862.31 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12749
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.93| 11| 26| 97| 107| 2
---------------------------------------------------------------------------
97- 107 (20.00/11.13) EKCQQLLNSIS
125- 135 (18.93/10.22) EESEQLLNQRS
---------------------------------------------------------------------------
|