<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12744
Description |
mediator of RNA polymerase II transcription subunit 9-like isoform X3 |
Sequence | MDPYSGGSWMMIPSASNHNTSSITSNQEHSHLHQQYHHQLQPQQQQPQRHQQHHQHQSLASHFHLLHLVENLAEAIESGTREQHSDALVNELTSHFEKCQQLLNSISVSINTKAMLMDRSVSWRKASNS |
Length | 129 |
Position | Middle |
Organism | Nelumbo nucifera (Sacred lotus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.904 |
Instability index | 45.19 |
Isoelectric point | 6.55 |
Molecular weight | 14801.11 |
Publications | PubMed=23663246
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12744
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.92| 12| 14| 27| 39| 1
---------------------------------------------------------------------------
27- 39 (21.05/13.18) QEHSHLHQQyHHQ
44- 55 (25.87/11.62) QQQPQRHQQ.HHQ
---------------------------------------------------------------------------
|