<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12730
| Description |
mediator of RNA polymerase II transcription subunit 9-like isoform X3 |
| Sequence | MDPYSGGSWMMIPSASNHNASSITSNQDHSHLHQQYHHQLQQQLQQPQQQQPQRHQQHHQHQSLASHFHLLHLVENLSEAIESGTRDQHSDALVNELTSHFEKCQQLLNSISVSINTKAMLMDRSVRWRKASNS |
| Length | 134 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.975 |
| Instability index | 56.09 |
| Isoelectric point | 6.72 |
| Molecular weight | 15453.81 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12730
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.02| 14| 19| 27| 41| 1
---------------------------------------------------------------------------
27- 41 (24.70/11.89) QDHSHLHQQyHHQLQ
49- 62 (30.32/11.09) QQQPQRHQQ.HHQHQ
---------------------------------------------------------------------------
|