<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12719

Description U-box domain-containing protein 33-like isoform X1
SequenceMELLEPSPPEPSGDDSIQLFDSPTFPLAFHLGLRGPHIVPLSPEIAVDGADIVHVAVGNSIEKTIALLYWTFRRFKNLYICLLHIHQPSPTIPTLLGKLPANQANQETVSAYRKEEMERTKKLLFNYLGICHRAKVKASIIAIESGQVQKGILDLVNMRSIKKLVMGTASDNCMKVKNSTKANYVAKNAPAFCQVWFVNKGKHVWTRESSESPNVLPPENVHAERLRSSLPHNHKPEIIFNPECFRSTSIPGRVSNGVSSCNQLEQDETEETLSTSGSCSLDRFDLIGTISGHASSTERRVSSESDLNLEKERLYNQLEEARREVEASKNEACVELLRSKKLELEAIEAINKVKDFEASFLHEVELRKEVEEALRTTRQEQRNLLETREEVIRDLQKTMRNVAILDIQTHEAMRRRDEATGELRLIQASIETLRHEGQRIQQQKEEALCQLKRWRSCSQHGATKGKGLDGFVNHLPMFTEFSRLDLQTATCNFSESFKIGQGGYGCVYKGEIFDRSIAIKKLHPHNVQSISEFQQEVVVLSKLQHPHLVTLIGACPEAWSLVHEYLPNGNLQDHLFFRRNNPPLTWKTRMRIAARVSSALLFLHTYRPEKMIHGDLKPENILLDSEFNCKIGDFGICRLVPEETARCPSFRWNTEGKGAFPYMDPEIERTRDLTSKSDIYSFGIIILQLLTGRHPVGLVSEVRQAVSYGKLASILDPSAGEWPTFVARQLVDHGLKFCELNSRDRPELTPAIVRDLEQLHLAEERPVPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLANGRETSPMTNLKLSHLHLTPNHALRHAIQHWLCQY
Length837
PositionTail
OrganismNelumbo nucifera (Sacred lotus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
Aromaticity0.07
Grand average of hydropathy-0.401
Instability index54.18
Isoelectric point6.65
Molecular weight94982.35
Publications
PubMed=23663246

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12719
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.53|      14|      17|     218|     231|       1
---------------------------------------------------------------------------
  218-  231 (25.78/16.27)	PENV.HAERLRS.SLP
  236-  251 (18.75/ 9.66)	PEIIfNPECFRStSIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.62|      22|      23|     299|     321|       2
---------------------------------------------------------------------------
  299-  321 (31.94/28.43)	RRV.SSESDLNLEKERlYNQLE.EA
  323-  346 (26.68/17.67)	REVeASKNEACVELLR.SKKLElEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.62|      13|      17|     371|     383|       5
---------------------------------------------------------------------------
  371-  383 (21.69/15.01)	EEALRTTRQEQRN
  389-  401 (21.93/15.27)	EEVIRDLQKTMRN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.26|      32|     531|     186|     217|       6
---------------------------------------------------------------------------
  186-  217 (59.12/43.13)	AKNAPAFCQVWFVNKGKHVWTRESSESPNVLP
  719-  750 (58.14/42.28)	AGEWPTFVARQLVDHGLKFCELNSRDRPELTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.62|      14|      16|     260|     274|       7
---------------------------------------------------------------------------
  260-  274 (19.88/13.06)	SCNqLEQDETEETLS
  278-  291 (24.74/12.08)	SCS.LDRFDLIGTIS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12719 with Med32 domain of Kingdom Viridiplantae

Unable to open file!