<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12719

Description U-box domain-containing protein 33-like isoform X1
SequenceMELLEPSPPEPSGDDSIQLFDSPTFPLAFHLGLRGPHIVPLSPEIAVDGADIVHVAVGNSIEKTIALLYWTFRRFKNLYICLLHIHQPSPTIPTLLGKLPANQANQETVSAYRKEEMERTKKLLFNYLGICHRAKVKASIIAIESGQVQKGILDLVNMRSIKKLVMGTASDNCMKVKNSTKANYVAKNAPAFCQVWFVNKGKHVWTRESSESPNVLPPENVHAERLRSSLPHNHKPEIIFNPECFRSTSIPGRVSNGVSSCNQLEQDETEETLSTSGSCSLDRFDLIGTISGHASSTERRVSSESDLNLEKERLYNQLEEARREVEASKNEACVELLRSKKLELEAIEAINKVKDFEASFLHEVELRKEVEEALRTTRQEQRNLLETREEVIRDLQKTMRNVAILDIQTHEAMRRRDEATGELRLIQASIETLRHEGQRIQQQKEEALCQLKRWRSCSQHGATKGKGLDGFVNHLPMFTEFSRLDLQTATCNFSESFKIGQGGYGCVYKGEIFDRSIAIKKLHPHNVQSISEFQQEVVVLSKLQHPHLVTLIGACPEAWSLVHEYLPNGNLQDHLFFRRNNPPLTWKTRMRIAARVSSALLFLHTYRPEKMIHGDLKPENILLDSEFNCKIGDFGICRLVPEETARCPSFRWNTEGKGAFPYMDPEIERTRDLTSKSDIYSFGIIILQLLTGRHPVGLVSEVRQAVSYGKLASILDPSAGEWPTFVARQLVDHGLKFCELNSRDRPELTPAIVRDLEQLHLAEERPVPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLANGRETSPMTNLKLSHLHLTPNHALRHAIQHWLCQY
Length837
PositionTail
OrganismNelumbo nucifera (Sacred lotus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
Aromaticity0.07
Grand average of hydropathy-0.401
Instability index54.18
Isoelectric point6.65
Molecular weight94982.35
Publications
PubMed=23663246

Function

Annotated function Functions as an E3 ubiquitin ligase.
ECO:0000256	ARBA:ARBA00003861
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12719
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.53|      14|      17|     218|     231|       1
---------------------------------------------------------------------------
  218-  231 (25.78/16.27)	PENV.HAERLRS.SLP
  236-  251 (18.75/ 9.66)	PEIIfNPECFRStSIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.62|      22|      23|     299|     321|       2
---------------------------------------------------------------------------
  299-  321 (31.94/28.43)	RRV.SSESDLNLEKERlYNQLE.EA
  323-  346 (26.68/17.67)	REVeASKNEACVELLR.SKKLElEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.62|      13|      17|     371|     383|       5
---------------------------------------------------------------------------
  371-  383 (21.69/15.01)	EEALRTTRQEQRN
  389-  401 (21.93/15.27)	EEVIRDLQKTMRN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.26|      32|     531|     186|     217|       6
---------------------------------------------------------------------------
  186-  217 (59.12/43.13)	AKNAPAFCQVWFVNKGKHVWTRESSESPNVLP
  719-  750 (58.14/42.28)	AGEWPTFVARQLVDHGLKFCELNSRDRPELTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.62|      14|      16|     260|     274|       7
---------------------------------------------------------------------------
  260-  274 (19.88/13.06)	SCNqLEQDETEETLS
  278-  291 (24.74/12.08)	SCS.LDRFDLIGTIS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12719 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
NANANA