<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12716
| Description |
mediator of RNA polymerase II transcription subunit 30-like isoform X1 |
| Sequence | MMEEKGVISNTKSTQDLAVEGLKHLEDTIEAAFQILSSMNDELCNPALWPVAHSSSGDASDSSHHSEMGSGALEEARLRYKSSIASLRSIISAIPNSRKAKAYEAGFTNGSSESHADQAEIEKLEEKATSLRKAIKLVRGLHHPNRFLVIFPKHVSFFHGAYSQSIQLQLQTSRILQLP |
| Length | 179 |
| Position | Head |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.370 |
| Instability index | 48.69 |
| Isoelectric point | 6.50 |
| Molecular weight | 19670.94 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12716
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.94| 12| 49| 58| 75| 2
---------------------------------------------------------------------------
37- 48 (22.75/14.25) SSMNDELCNPAL
62- 73 (22.19/11.90) SSHHSEMGSGAL
---------------------------------------------------------------------------
|