<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12715
| Description |
mediator of RNA polymerase II transcription subunit 9-like isoform X2 |
| Sequence | MDPYSGGSWMMIPSASNHNASSITSNQDHSHLHQQYHHQLQQQLQQPQQQQPQRHQQHHQHQSLASHFHLLHLVENLSEAIESGTRDQHSDALVNELTSHFEKCQQLLNSISVSINTKAMTVDGQKRKMEESEQLLNQRSLIL |
| Length | 143 |
| Position | Middle |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.953 |
| Instability index | 60.16 |
| Isoelectric point | 6.28 |
| Molecular weight | 16463.95 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12715
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.71| 13| 21| 27| 39| 1
---------------------------------------------------------------------------
27- 39 (27.91/10.51) QDHSHLHQQYH.HQ
49- 62 (23.80/ 7.97) QQQPQRHQQHHqHQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.78| 19| 25| 94| 112| 2
---------------------------------------------------------------------------
94- 112 (32.81/17.93) VNELTSHFEKCQQLLNSIS
122- 140 (31.97/17.33) VDGQKRKMEESEQLLNQRS
---------------------------------------------------------------------------
|