<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12709
| Description |
mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MSNVKSTQELAAGGLKHLEDTIEAAFQILSSMNDELCNPALWSTTVSAHSSNGIVSGDTADSSHHLEMGGGALEDARLRYKSSVASLRAVLSAIPNSQKAKAYETGSIVASSESQANQAETENLEERATNLRKELANKHKHLKLLIDQLRVVITDISTWQSPCSV |
| Length | 165 |
| Position | Head |
| Organism | Nelumbo nucifera (Sacred lotus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.335 |
| Instability index | 39.95 |
| Isoelectric point | 5.65 |
| Molecular weight | 17731.58 |
| Publications | PubMed=23663246
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12709
No repeats found
No repeats found
|