<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12703

Description cyclin-dependent kinase E-1 isoform X1
SequenceMSAGSGNSSMSSRGSIGSSTHNNATATANSSSGSNSNSNKPAWLQQYDLIGKIGEGTYGLVFLARTKSNPNRGKCIAIKKFKQSKDGDGVSPTAIREIMLLREINHENVVKLVNVHINHADMSLYLAFDYAEHDLYEIIRHHREKVNHSINQYTIKSLLWQLLNGLNYLHSNWIIHRDLKPSNILVMGEGEEQGVVKIADFGLARIYQAPLKPLSENGVVVTIWYRAPELLLGAKHYTSAVDMWAVGCIFAELLTLKPLFQGAEVKATPNPFQLDQLDKIFKVLGHPTQEKWPTLVNLPHWQSDQQHIQGRKYSDNPGLYSVVHLSQKSPPYDLLSKMLEYDPRKRITAAQALEHEYFRIDPLPGRNALVPGQPGEKVVNYPARPVDTSTDFEGTATVQPSQPVSSGNAVSGSVAAAPVVAARSVPRPMPMVGMQQRVQPPPGMTAFNLASQAGMGGGMNPGSSIPMRAAAAQAHQQQQLRRKDAGMGMPGYPPPQKRRY
Length500
PositionKinase
OrganismNelumbo nucifera (Sacred lotus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
Aromaticity0.07
Grand average of hydropathy-0.407
Instability index41.79
Isoelectric point9.43
Molecular weight54945.99
Publications
PubMed=23663246

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central

GO - Biological Process
protein phosphorylation	GO:0006468	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12703
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     203.09|      49|      52|     392|     442|       1
---------------------------------------------------------------------------
  365-  387 (35.35/13.85)	..GRNALVPGQP...GE....KVVNYP...AR................PVD
  392-  442 (81.89/45.46)	FEGTATVQPSQPVSSGNAVSGSVAAAPVVAARSVPRPMPMVGMQQrvQPPP
  447-  495 (85.86/43.02)	FNLASQAGMGGGMNPGSSIPMRAAAAQAHQQQQLRRKDAGMGMPG..YPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.69|      28|      43|     185|     214|       2
---------------------------------------------------------------------------
  185-  214 (43.53/28.05)	LVMGEGEEQGVVKIADFGLarIYQA..PLKPL
  230-  259 (45.16/23.80)	LLLGAKHYTSAVDMWAVGC..IFAEllTLKPL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12703 with CDK8 domain of Kingdom Viridiplantae
Unable to open file!