<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12701
Description |
mediator of RNA polymerase II transcription subunit 22a-like isoform X1 |
Sequence | MNKGVGVGVGGGVGVGLGGAGSGPTAAAAAAAAQKQKTLLQRVDTDITNIVDNFSHLVNVARVNDPPVKNSQEAFMMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNEHVEQRITEFNQQAEKTDRLLAQIGEEAAASLKELESHYYTSIQRTDQLEP |
Length | 162 |
Position | Head |
Organism | Nelumbo nucifera (Sacred lotus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.220 |
Instability index | 25.23 |
Isoelectric point | 5.37 |
Molecular weight | 17254.24 |
Publications | PubMed=23663246
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP12701
No repeats found
No repeats found
|