<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12694
| Description |
mediator of RNA polymerase II transcription subunit 16-like isoform X1 |
| Sequence | MNNQQPPAPPPVAVKDSEEESSSAITTTNSLEASIKVQDKPDTGEDDHPGAAIVTTEKEVSSVDNDDPMDEDSVNPATVFCIRLKQPRSNLLHKMSVPELCRNFRLVLTRRIGIPFCISALVCYGKTKNRKGDYGLS |
| Length | 137 |
| Position | Tail |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.551 |
| Instability index | 49.03 |
| Isoelectric point | 5.16 |
| Molecular weight | 14985.71 |
| Publications | PubMed=23773524
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12694
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.31| 14| 37| 10| 23| 1
---------------------------------------------------------------------------
10- 23 (24.06/17.91) PPVAVKDSEEESSS
49- 62 (23.25/17.08) PGAAIVTTEKEVSS
---------------------------------------------------------------------------
|