<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12690
Description |
mediator of RNA polymerase II transcription subunit 32-like isoform X1 |
Sequence | MYVLIPPNSLVFWFRTDPSIPNLCNFVDVELIDRALGEKHSRQRFFITEGQDVQGSKLQSLSPVISILVRILCVIQPQIHISRNLMMDSMINSLNSAYQDFIAAAAGVLEAKDNSSGLRTATTDAALENFKQCWELFRVACDQVEEFVESVKQRIGSECLVDEATGSGPLKPGQTTTTSLPPISAVRLEQMSKAVRWLVIELLPSSGTDASTASHSHSSVPFDARFSEDAAH |
Length | 232 |
Position | Tail |
Organism | Nelumbo nucifera (Sacred lotus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Proteales> Nelumbonaceae> Nelumbo.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.028 |
Instability index | 52.60 |
Isoelectric point | 5.11 |
Molecular weight | 25526.73 |
Publications | PubMed=23663246
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP12690
No repeats found
|