Description | probable mediator of RNA polymerase II transcription subunit 26c isoform X3 |
Sequence | MELDEFRLMLENSSVDLWTFIDTAISVAIRDHENELLSRRDAIVEKLNAPLLCKNCNSAGNYEDLETKIIRIKKLLEYPNQSENCLVELLQTLAEMDISFKVLEITDVGRHVNRLRKHSSNEVRRLVKLLIRRRKDIVDEWVRLNTPPEETGDADSPFQPHLNNNFEERAPLYGISPNGSSSYCARK |
Length | 187 |
Position | Unknown |
Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.513 |
Instability index | 40.54 |
Isoelectric point | 5.49 |
Molecular weight | 21637.35 |
Publications | PubMed=23773524 |
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP12671 No repeats found |
MoRF Sequence | Start | Stop |
1) RAPLYGI 2) SYCARK | 169 182 | 175 187 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab