<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12670

Description U-box domain-containing protein 35-like isoform X2
SequenceMFESRSHQIVAGGGNEAAPDANGGSSDEDTQNVFTPFRAYSARKRIVVKEIVLEDTEVSKGLVDYINGHCVTNIVLGASSRSALGRKYWTPDVPTIINKAAPEFCTVYVVSKGRQQSVRPAAKPLTSSVSARQHSSSAWTPSRLSNSESEDISRLSFARAEPKIIESEKTRPEKGPSNVVIDHLHAPSGGPMNSCSRTSQSDGNELFARINHRSVDISADNLDFTQVAIKETPRNGSSSYTLEAEMKRLKLELRQTLDMYNAACKEAVLANQAAEELNKWKMEEARRFEQARLAEEAALAIAETEKAKCRAAIEAAKKAQKMAEIEAQRRKYAELKAKREGEKKNRAMNVLSQNDLRYRKYTIEEIEAATKNFSSSLKVGEGGYGPVFKGKLDHTPVAIKVLSADAAQGKKQFQQEVEVLSLIRHPNLVLLLGACPEYGCLVYEFMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPANILLDRNYVCKISDVGLARLVPPSVADTVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDVYSLGIMLLQIITARPPMGLTHHVERAIEKGTFADLLDPTVQNWPVEEALKFAKLSLKCAELRMKDRPDLGSVIVPELSKLKEVGINSMPSISS
Length652
PositionTail
OrganismNicotiana sylvestris (Wood tobacco) (South American tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.397
Instability index41.25
Isoelectric point8.66
Molecular weight72031.33
Publications
PubMed=23773524

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12670
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.44|      39|      49|     119|     159|       1
---------------------------------------------------------------------------
  119-  159 (58.14/42.75)	RPAAKPlTSSVSARQHSSSAWTPSRLSNSESEDISRLsFAR
  171-  209 (71.30/43.60)	RPEKGP.SNVVIDHLHAPSGGPMNSCSRTSQSDGNEL.FAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.97|      21|      49|     347|     367|       2
---------------------------------------------------------------------------
  347-  367 (35.45/22.71)	AMNVLSQNDLRYRKYTIEEIE
  398-  418 (33.52/21.12)	AIKVLSADAAQGKKQFQQEVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.17|      25|      50|     428|     454|       3
---------------------------------------------------------------------------
  428-  454 (41.10/32.88)	LVLLLGACPEygCLVY.EFMNNGSLEDR
  480-  505 (40.07/24.52)	LLFLHQAKPE..PLVHrDLKPANILLDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.72|      22|      41|     272|     293|       4
---------------------------------------------------------------------------
  272-  293 (37.44/22.56)	QAAEELNKWKMEEARRFEQARL
  314-  335 (34.28/20.11)	EAAKKAQKMAEIEAQRRKYAEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.46|      10|      34|     222|     231|       8
---------------------------------------------------------------------------
  222-  231 (17.13/12.87)	LDFTQVAIKE
  257-  266 (19.33/15.49)	LDMYNAACKE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12670 with Med32 domain of Kingdom Viridiplantae

Unable to open file!