<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12661

Description U-box domain-containing protein 35-like isoform X1
SequenceMASSDDGGSHHRPIVVAVDKDKNSASAVKWAVDNLLTTNPNLVLLHVRIKKSPNPGGGNEAAPDANGGSSDEDTQNVFTPFRAYSARKRIVVKEIVLEDTEVSKGLVDYINGHCVTNIVLGASSRSALGRKYWTPDVPTIINKAAPEFCTVYVVSKGRQQSVRPAAKPLTSSVSARQHSSSAWTPSRLSNSESEDISRLSFARAEPKIIESEKTRPEKGPSNVVIDHLHAPSGGPMNSCSRTSQSDGNELFARINHRSVDISADNLDFTQVAIKETPRNGSSSYTLEAEMKRLKLELRQTLDMYNAACKEAVLANQAAEELNKWKMEEARRFEQARLAEEAALAIAETEKAKCRAAIEAAKKAQKMAEIEAQRRKYAELKAKREGEKKNRAMNVLSQNDLRYRKYTIEEIEAATKNFSSSLKVGEGGYGPVFKGKLDHTPVAIKVLSADAAQGKKQFQQEVEVLSLIRHPNLVLLLGACPEYGCLVYEFMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQAKPEPLVHRDLKPANILLDRNYVCKISDVGLARLVPPSVADTVTQYHMTSAAGTFCYIDPEYQQTGKLGTKSDVYSLGIMLLQIITARPPMGLTHHVERAIEKGTFADLLDPTVQNWPVEEALKFAKLSLKCAELRMKDRPDLGSVIVPELSKLKEVGINSMPSISS
Length696
PositionTail
OrganismNicotiana sylvestris (Wood tobacco) (South American tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.398
Instability index38.28
Isoelectric point8.80
Molecular weight76641.52
Publications
PubMed=23773524

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12661
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.44|      39|      49|     163|     203|       1
---------------------------------------------------------------------------
  163-  203 (58.14/50.02)	RPAAKPlTSSVSARQHSSSAWTPSRLSNSESEDISRLsFAR
  215-  253 (71.30/51.01)	RPEKGP.SNVVIDHLHAPSGGPMNSCSRTSQSDGNEL.FAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.97|      21|      49|     391|     411|       2
---------------------------------------------------------------------------
  391-  411 (35.45/24.44)	AMNVLSQNDLRYRKYTIEEIE
  442-  462 (33.52/22.73)	AIKVLSADAAQGKKQFQQEVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.17|      25|      50|     472|     498|       3
---------------------------------------------------------------------------
  472-  498 (41.10/36.58)	LVLLLGACPEygCLVY.EFMNNGSLEDR
  524-  549 (40.07/27.35)	LLFLHQAKPE..PLVHrDLKPANILLDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.72|      22|      41|     316|     337|       4
---------------------------------------------------------------------------
  316-  337 (37.44/23.65)	QAAEELNKWKMEEARRFEQARL
  358-  379 (34.28/21.09)	EAAKKAQKMAEIEAQRRKYAEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.46|      10|      34|     266|     275|       8
---------------------------------------------------------------------------
  266-  275 (17.13/10.10)	LDFTQVAIKE
  301-  310 (19.33/12.17)	LDMYNAACKE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12661 with Med32 domain of Kingdom Viridiplantae

Unable to open file!