<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12651
| Description |
mediator of RNA polymerase II transcription subunit 4-like |
| Sequence | TTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFANLDVGLPKTDDDKEKIIEPLIEPSADITNLSAIPGLIPPNIIVPSGWKPGMPVELPTDLPLPPPGWKPGDPIALPPVDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSEASSDSED |
| Length | 169 |
| Position | Middle |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.442 |
| Instability index | 80.08 |
| Isoelectric point | 4.17 |
| Molecular weight | 18032.17 |
| Publications | PubMed=23773524
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12651
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.41| 17| 18| 83| 100| 1
---------------------------------------------------------------------------
83- 99 (38.13/11.39) GWKPGMPVELPT.D.LPLP
102- 120 (30.28/ 8.93) GWKPGDPIALPPvDsLPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.85| 15| 18| 44| 60| 2
---------------------------------------------------------------------------
46- 60 (25.78/14.92) TDDDKEKIIEPLIEP
62- 76 (26.07/ 8.72) ADITNLSAIPGLIPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.83| 22| 112| 12| 33| 3
---------------------------------------------------------------------------
12- 33 (40.94/18.51) QAPLRG....ALPPAPQDEQMRASQL
125- 150 (36.89/15.98) EAPARPvpppGLPRMPEPIQVRHVQL
---------------------------------------------------------------------------
|