<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12630
| Description |
cyclin-C1-2-like |
| Sequence | MSANFWTSSHYKELLDAEEVDVVHQLDKERGITLDDFKLIKLHMSNYIARLAQNVKVRQRVVATAITYMRRVYIRRSMTEYDPRLVAPSCLYLASKSEESTVQARLLVFYIKKLYSDDKYRYEIKDILDMEMKILEALNYYLVIFHPYRSLSQLLQDAGMNDTAQLTWGLVNDTYKMDLILIHPPHLIALACIYIASVLKDKETTAWFEELRVDVNVVKNISMEILDFYDGHKMITDERVSAAMSKLVGK |
| Length | 250 |
| Position | Kinase |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.111 |
| Instability index | 44.76 |
| Isoelectric point | 6.39 |
| Molecular weight | 29177.58 |
| Publications | PubMed=23773524
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12630
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.93| 12| 34| 40| 51| 1
---------------------------------------------------------------------------
40- 51 (21.50/13.46) IKLHMSNYIARL
74- 85 (22.43/14.31) IRRSMTEYDPRL
---------------------------------------------------------------------------
|