<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12617

Description uncharacterized protein LOC104227178 isoform X6
SequenceMDSADWRTQLLPDSRQRIVNNITETLKRQLSVTREEGVQELKKIAVGFEEKIYTAATSQPDYLQKISLKILTMETKSHNPMTNLSNAASSGQNAHDPGTARAGAAAGAMDAADWRTQLLPDFRQSIVNKITETLKRHLPVTGEEGVQELKKIALRFEEKIYTAAISQPDYLRKISLKMLTMETKSQHPTTNSINAASSGQNALGPDSCQEREITQGSMKRKREDWGDNVEEHNDQILPTFTCEICTEVVPITKKFNNFHSCNHSFCSKCIERHVEVKIQLRIADIQCPYVDCGKLLDPLVCRTMIPLSIFEKWCDLLCKQAHLGFEKCYCPYQDCGELIVKECGDVVGKSECPNCRRLICFQCGLPWNVCEENGCSKVNDTLFKELVEQKQWTKCPSCNMYVERIAGCNHMQCRFSLSLSLSLSLSLSLHMVLTFTLI
Length438
PositionTail
OrganismNicotiana sylvestris (Wood tobacco) (South American tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.355
Instability index38.75
Isoelectric point6.81
Molecular weight49473.40
Publications
PubMed=23773524

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
metal ion binding	GO:0046872	IEA:UniProtKB-KW
transcription coactivator activity	GO:0003713	IEA:InterPro
transferase activity	GO:0016740	IEA:UniProtKB-KW
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12617
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     384.36|      97|     107|       1|     107|       1
---------------------------------------------------------------------------
    1-   97 (191.33/127.68)	MDSADWRTQLLPDSRQRIVNNITETLKRQLSVTREEGVQELKKIAVGFEEKIYTAATSQPDYLQKISLKILTMETKSHNPMTNLSNAASSGQNAHDP
  109-  205 (193.03/144.64)	MDAADWRTQLLPDFRQSIVNKITETLKRHLPVTGEEGVQELKKIALRFEEKIYTAAISQPDYLRKISLKMLTMETKSQHPTTNSINAASSGQNALGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     184.92|      40|      40|     287|     326|       2
---------------------------------------------------------------------------
  244-  283 (23.12/ 9.59)	.................IC.TEVVPItkkfnnfhSCNHS.FC....S.KCIERHvevkiqLRIA
  287-  326 (77.16/50.83)	CP....YVDCGKLLDPLVC.RTMIPL........SIFEK.WC....DLLCKQAH......LGFE
  330-  350 (26.81/12.41)	CP....YQDCGELIVK.EC.GDVVGK........S.............................
  352-  385 (34.55/18.32)	CP......NCRR....LICfQCGLPW........NVCEEnGCskvnDTLFKE............
  395-  421 (23.28/ 9.72)	CPscnmYVERIAGCNHMQC.RFSLSL........SL............................
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12617 with Med15 domain of Kingdom Viridiplantae

Unable to open file!