<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12588
Description |
mediator of RNA polymerase II transcription subunit 19a-like |
Sequence | MDPDIRKFGRGPRELGGSVDLLNHCKLRKHLDLFCKRSLPLSISETQYLRNVVGDTEIRKGEGMELDQLSQNSPYVGHRCVQLRPFGLDLLTDAFQLREATSTDLPLAEIGFPIGASKLKNECKEKKKHKKHKHKDRSRKHDPSSCTDKEPKPSRVNNKEKNESKSQNYGPDLFLRQQVKKPRTDGNGGFSGILTYQKNELNKAFRRS |
Length | 208 |
Position | Head |
Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -1.051 |
Instability index | 47.96 |
Isoelectric point | 9.70 |
Molecular weight | 23754.79 |
Publications | PubMed=23773524
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP12588
No repeats found
No repeats found
|