<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12584
| Description |
mediator of RNA polymerase II transcription subunit 21-like |
| Sequence | MGSWSSMAVRGWSTRLLLVWGDGGDGLFGCLVEQLVVRRRLCVCVEQQQPWRAVSGGTRKKMTGVAASMATLSSNSLTRLGCNCDWSISEKDNYKNIGRIHKVDIISQLQEQVNTIAALAFNTFGTLQRDAPPVRLSPNYPEPPPANPTEDAANVAEQPKQMSAAFVKAAKQFDALVAALPLSDGGEEAQLKRIAELQAESDVVGQELQKQLEAAEKELKQVQELFNQATDNCLNLKKPE |
| Length | 240 |
| Position | Middle |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.336 |
| Instability index | 56.34 |
| Isoelectric point | 5.66 |
| Molecular weight | 26239.56 |
| Publications | PubMed=23773524
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12584
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 128.85| 32| 43| 111| 142| 1
---------------------------------------------------------------------------
69- 96 (31.83/16.48) .....MATLSSNSLTRLGCNC..DwSISEKDNYKN
111- 142 (54.88/32.70) EQVNTIAALAFNTFGTLQRDA..P.PVRLSPNYPE
157- 188 (42.14/23.73) EQPKQMSA.AF.VKAAKQFDAlvA.ALPLSDGGEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.98| 19| 27| 190| 210| 2
---------------------------------------------------------------------------
190- 210 (25.47/24.28) QLKRIAEL..QAESDVVgqELQK
218- 238 (27.51/18.19) ELKQVQELfnQATDNCL..NLKK
---------------------------------------------------------------------------
|