<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12579
| Description |
mediator of RNA polymerase II transcription subunit 22a-like |
| Sequence | MNKGGVGGSGGGGGPTAAAAAAAAQKQKSLLQRVDADIGNIVDNFSFLVNVARVNDPPVRNSQEAFMMEMRASRMVQAADTLLKLVSELKQTAIFSGFASLNDHVEQRTEEFTEQAEKTECMLSRIGEEAAASLKELESHYYSSAERTSSLPSYSQETMP |
| Length | 160 |
| Position | Head |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.369 |
| Instability index | 52.36 |
| Isoelectric point | 4.97 |
| Molecular weight | 17165.98 |
| Publications | PubMed=23773524
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12579
No repeats found
|