<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12571
| Description |
mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MEEKGGTMANPKTIQELAVEGQKHLEDTIEAAHQILSAMNDELCNPTLWSTTPNTAATTSANAVMSNGQQQHHSNGGGDVSSDNSSSSSASAQQHLDIGGGALDESRLRYKSSIACLRSVLTAISNSQKAKALEAASASGSLSAADQAEIEQLEERASTLKKELVDKNKHLKLLIDQLRYLLSDLSTWQSPCST |
| Length | 194 |
| Position | Head |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.509 |
| Instability index | 46.56 |
| Isoelectric point | 5.19 |
| Molecular weight | 20623.54 |
| Publications | PubMed=23773524
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12571
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.60| 21| 22| 70| 90| 1
---------------------------------------------------------------------------
70- 90 (39.13/24.44) QQHHSNGGG..DVSSDNSSSSSA
93- 115 (32.48/19.20) QQHLDIGGGalDESRLRYKSSIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.83| 22| 144| 15| 37| 2
---------------------------------------------------------------------------
15- 37 (32.62/29.47) QELaVEGQKHLEDTIEAAHQILS
162- 183 (36.21/27.31) KEL.VDKNKHLKLLIDQLRYLLS
---------------------------------------------------------------------------
|