<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12555
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQNVQHQLLQSPARLGLPTPSSPSLQNPTAPPKFSSQVSQHLQPHQQANILTTTTTSSTLLPLLPPLSRAQSLLIQMASLSSRLFEVSPNRSHWLSAFRGSFPSFLPSAAPVPQDSYPSSSKETLSVFTSLQTQLFEAVAELQEILDLQDEKQKVTREIRSNDSAILAFANKLKGAERVLDNLVDDYSDYRRPKRVKLENDIEESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFADLDVGLPKLDEGKEKIIEPLIEPAVETNPLANIQGLITPNIVVPSGWKPGMPVELPTDLPLPPPGWKPGDPIALPPFDSLSLPPKVEEVPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSDEASSDSED |
| Length | 399 |
| Position | Middle |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.389 |
| Instability index | 78.18 |
| Isoelectric point | 4.82 |
| Molecular weight | 43676.81 |
| Publications | PubMed=23773524
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12555
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 170.18| 51| 76| 234| 295| 1
---------------------------------------------------------------------------
234- 289 (76.95/43.69) PPEFGAG...QAPLRGALPPaPQDEQMRASQLYNFADLDVGlPKLDEGKEKIIEPlieP
310- 363 (93.23/33.34) PSGWKPGmpvELPTDLPLPP.PGWKPGDPIALPPFDSLSLP.PKVEEVPARPVPP...P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.38| 21| 77| 12| 33| 3
---------------------------------------------------------------------------
12- 33 (37.07/23.65) SPAR...LGLPTPSSPSLQnPTAPP
89- 112 (35.31/17.69) SPNRshwLSAFRGSFPSFL.PSAAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.04| 12| 15| 178| 189| 4
---------------------------------------------------------------------------
178- 189 (20.71/17.98) ERV.LDNLVDDYS
195- 207 (15.34/11.29) KRVkLENDIEESS
---------------------------------------------------------------------------
|