| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKTINARHQGSAGAEGTMENFTALFGAQADPPPPPTSLGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSVAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKDKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Tarsius syrichta (Philippine tarsier) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Tarsiiformes> Tarsiidae> Carlito. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.004 |
| Instability index | 60.21 |
| Isoelectric point | 9.81 |
| Molecular weight | 28022.68 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP12523
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.51| 16| 16| 31| 46| 1
---------------------------------------------------------------------------
31- 46 (36.21/11.32) PPPPPTSLGFGPGKPP
48- 63 (37.30/11.87) PPPPPPGGGPGTAPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 98.77| 22| 39| 189| 210| 2
---------------------------------------------------------------------------
175- 203 (30.80/11.52) PLPeqcrlmhiqP..PKKKDKHKHKQSRTQD
204- 225 (38.57/16.06) PVP.........PETPSDSDHKKKKKKKEED
226- 245 (29.41/10.71) ..P.........ERKRKKKEKKKKKNRHSPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.35| 14| 39| 84| 97| 3
---------------------------------------------------------------------------
84- 97 (24.53/13.31) LMRELPGSTELTGS
125- 138 (26.81/15.19) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) NFTALFG | 212 20 | 246 26 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab