<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12510
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | SGGPGPRPPAAAAALGFGPGKPAGPGSAPPPAAAAPQSVEDQSRKTAASSGPFYLMRELPGNTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICSSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR |
| Length | 224 |
| Position | Head |
| Organism | Alligator sinensis (Chinese alligator) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.052 |
| Instability index | 69.48 |
| Isoelectric point | 9.98 |
| Molecular weight | 25078.28 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12510
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.75| 16| 18| 178| 193| 1
---------------------------------------------------------------------------
159- 174 (26.09/11.93) PKKKNKHKHKQSRTQD
178- 193 (27.27/12.79) PETPSDSDHKKKKKKK
197- 212 (26.39/12.16) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.28| 14| 38| 55| 68| 3
---------------------------------------------------------------------------
55- 68 (25.63/12.45) LMRELPGNTELTGS
96- 109 (27.66/13.89) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|