Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | SGGPGPRPPAAAAALGFGPGKPAGPGSAPPPAAAAPQSVEDQSRKTAASSGPFYLMRELPGNTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICSSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR |
Length | 224 |
Position | Head |
Organism | Alligator sinensis (Chinese alligator) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae> Alligator. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.052 |
Instability index | 69.48 |
Isoelectric point | 9.98 |
Molecular weight | 25078.28 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP12510 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.75| 16| 18| 178| 193| 1 --------------------------------------------------------------------------- 159- 174 (26.09/11.93) PKKKNKHKHKQSRTQD 178- 193 (27.27/12.79) PETPSDSDHKKKKKKK 197- 212 (26.39/12.16) PERKRKKKEKKKKKNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.28| 14| 38| 55| 68| 3 --------------------------------------------------------------------------- 55- 68 (25.63/12.45) LMRELPGNTELTGS 96- 109 (27.66/13.89) FLPDLPGMIDLPGS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHP 2) SGGPGPRPPAAAAALGFGPGKPA | 183 1 | 218 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab