<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12491
Description |
mediator of RNA polymerase II transcription subunit 29 |
Sequence | MAAPQPQASAVSSAAAGVSGPGSAGGPGPQPQPQPAQLVGAAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTTAASTGPGGSL |
Length | 200 |
Position | Tail |
Organism | Mesocricetus auratus (Golden hamster) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Mesocricetus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.290 |
Instability index | 60.34 |
Isoelectric point | 5.86 |
Molecular weight | 20964.54 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12491
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.37| 14| 26| 4| 17| 1
---------------------------------------------------------------------------
4- 17 (25.68/12.60) PQPQ...ASAVSSAAAG
29- 45 (21.69/ 9.60) PQPQpqpAQLVGAAQSG
---------------------------------------------------------------------------
|