<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12474
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MKAQGETEESERLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNATPLDKILHGSVGYLTPRSGGHLMNIKYYASPSDLLDDKTASPIILHEKNVPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSVTSANSVDLPACFFLKFPKPIPVSKTFVQKLQNCTGIPLFETPPTYVPLYELITQFELSKDPDPLPLNHNMRFYAALPGQQHCYFLNKDAPLPDGQSLQGTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVKRTVLKEDTPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGSKHPELGSG |
| Length | 556 |
| Position | Middle |
| Organism | Mesocricetus auratus (Golden hamster) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Mesocricetus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.200 |
| Instability index | 49.79 |
| Isoelectric point | 8.12 |
| Molecular weight | 61660.61 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12474
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 298.03| 74| 97| 382| 457| 2
---------------------------------------------------------------------------
272- 317 (37.08/19.00) ........................................PLI..MGSHPVD.NKWTPS..FSSVTSANSvDLPAcfFLKFpKPIPVSKT.F.......
319- 381 (37.31/18.88) ...QKLQNCtgiplfetpptyvpLYELITQfelsKDPDPLPLNHNM.RF...YAALPGQqhCY...FLNK.DAP.........................
383- 457 (124.53/84.17) PDGQSLQGT..............LVSKITF....QHPGRVPLILNMIRHQVAYNTLIGS..CVKRTVLKE.DTPG..LLQF.EVCPLSESrFSVSFQHP
484- 551 (99.11/65.45) SDALICTDD..............FIAKVV.....QRCMSIPVTMRAIRRKA..ETIQAD..TPALSLIAE.TVED..MVKK.NLPPAS....SPGSKHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 124.68| 38| 48| 146| 183| 4
---------------------------------------------------------------------------
146- 164 (21.69/ 8.18) ...............................NFD.....EFSKHLKGLVNLYNLP
165- 213 (52.79/28.81) GDNKLKTKMYLALQSLEQDlskmaimywkatNAT.....PLDKILHGSVG.YLTP
216- 269 (50.20/27.09) GGHLMNIKYYASPSDLLDD.ktaspiilhekNVPrslgmNASVTIEGTSAMYKLP
---------------------------------------------------------------------------
|