<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12469
| Description |
mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MSTPPLAPGGMASGPFGGPQAQQAAREVNTATLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVDEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 178 |
| Position | Head |
| Organism | Mesocricetus auratus (Golden hamster) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Cricetinae> Mesocricetus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.629 |
| Instability index | 43.94 |
| Isoelectric point | 8.45 |
| Molecular weight | 20286.03 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP12469
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 77| 97| 1
---------------------------------------------------------------------------
77- 97 (35.66/17.83) KLQDHLRQLSILFRKLR.LVYD
148- 169 (32.91/16.11) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|