<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12450

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDFPGGSVTNIRVLDGFSNIYWRIYTEDPNITNLPGEAPANGFTILKHLSRLKDLELRLRNSNCLVSSYPRRLGLWVFSATPEFESVRSLRSDESKGEQSRLAVGSSTLKVSASGSVTPRELVKNLSTDPQTAGGSTGSQRPQGTPTPTRRVDSYSSSVAIYAAFISAITGSLNLQLIRRSSAIPLGSRTLFTIIERDYYETSGIVNDDPSSISALTTLQVQLTSVGKLTVSLQTTSQPGIAPLCRLGESPSDICDVAPGADIWLSPSGSVARLVSTKPGPPNTSSPFPPTGSIGIDSLGAAGRKQWKANVLEWLRNFGLPMDSVHETAWVEVEVWEPFYSRLAGETLRLNEDNSSTLPLKRVLWPAVYCFRRTKSASPGSSQWIENACPVVGDPLDFAENWRVVEKPKQDETSPKPPSSHPEQQSRNPEPSAATTDILEGIESLSRASEYSDLQTVSLVYPTPPDGAAAMGLNLAGPSDTFAEEPDLVPSLLQNQSKPKYYEQLTTKDRSEADPSAGFGPLGGLAVGSGLYDTNEDDDLFGDMDERDFGTKGITDADFNFFDDPSFAAMDTDVPADDAQEVPGMVDLEVTEAHPTISEGALLEDFAAQKTPAEILEVAQASPDEVTPKVQPEHMDAEETTVAASPHIEQNQTISPPLSPVEIKRILLPEPEGDNHVPTKGSRKQSYYNPVAFKPNMSAWDQKYGADGKFRFTTAGPSASKVYTNSDIPTVGMPRRNKKYPTAGAGLMSLDGHASPSSEGQHLQTVSDSSSDTSDDSDGSASESDAPPLPSRKRKRARSNSVGSPAISQVKSLGEAEQEIPVHRPEHSIFLGNLLSTFSDWSMTGYFSLTENRLFPVLTRKDMQIQIAQLFVDQITQSSLDHKLDGGFCLSDLDNKAYSVQTFFEEEGILGTIERLDLNSWISLQENEQASPAPNGAVSRQSSQRKEMGKGSITKLSPPHLRVRRGKEYLEALPPAISFWETFGLEPADGPKDISAYCIHPQIAADAADVFLERLGLLYASCNLGKHVRGCRSSAFERGLCPWDVGSLETAHFLPAMQSLKLICEDLGTALLKSSPSNDSLVIYIINPFAHASALVDICSAFWCLFQKYIADTGKQQARQLNEVVLQIIPISFIMSTDSMVVPPQAQYLSLALEIYSRCPPKALQSSLVNCAPPVLLAEPLPRTISFRLASEKTSPLQEGKCLHIAYSKSQDQRWIGVAWSDNSGALQRTISYNLRYRNASAVRSISDVRSEIWVATKDILDRIQARWKVFVVSTGPVDQDEVDAWTSFIEQYNKANSIPLELTILSVNTAPDLHLEPPFLPMSMSIFNPQTSSTPVATPNASGNVFSPDQSGSAPTPPSGGNAPTNAPTPTEPTLEAETESVLTDICDESWGVILSHRLNNSPHLTEYRPALASGYLLRRKGDTDGDGVYAMTLNLIYTQRPSSCEAILRETLGMYRDLGTLARARGTRTVQRNTLPWHIATAVRAQEMLSHVL
Length1495
PositionKinase
OrganismAspergillus oryzae (Yellow koji mold)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati.
Aromaticity0.07
Grand average of hydropathy-0.350
Instability index55.82
Isoelectric point5.03
Molecular weight162824.59
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12450
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     115.79|      33|      34|     672|     704|       1
---------------------------------------------------------------------------
  672-  704 (61.99/41.78)	EGDNHVPTKG.SRKQSYYNPVAFKPNMSAWDQKY
  707-  740 (53.80/35.16)	DGKFRFTTAGpSASKVYTNSDIPTVGMPRRNKKY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.04|      14|      34|      79|      93|       2
---------------------------------------------------------------------------
   79-   93 (19.82/14.91)	SATPEfESVRSLRSD
  116-  129 (24.22/12.95)	SVTPR.ELVKNLSTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     142.15|      31|      34|     429|     459|       3
---------------------------------------------------------------------------
  429-  457 (43.58/22.57)	.....................PEP..SAATTDI.LEGI...ESLSRASEYSDLQTV
  458-  491 (36.24/17.42)	SL.................vyPTPpdGAAAMGLnLAG....PSDTFAEE.PDLVPS
  492-  540 (21.61/ 7.15)	LLqnqskpkyyeqlttkdrseADP..SAGFGP..LGGLavgSGLYDTNEDDDL...
  741-  766 (40.72/20.57)	.....................PTA..GAGLMS..LDGH...ASPS..SEGQHLQTV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.00|      13|      22|    1324|    1336|       4
---------------------------------------------------------------------------
 1324- 1336 (25.35/13.74)	SMSIFNP.QTSSTP
 1343- 1356 (20.65/ 9.67)	SGNVFSPdQSGSAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.06|      14|      15|     945|     959|       5
---------------------------------------------------------------------------
  945-  959 (21.47/18.10)	RKEMGKGSITKLsPP
  962-  975 (25.58/16.24)	RVRRGKEYLEAL.PP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.09|      16|      28|     579|     595|       6
---------------------------------------------------------------------------
  579-  595 (25.24/21.91)	AQEVPGMVdLEVTEAHP
  608-  623 (27.85/18.31)	AQKTPAEI.LEVAQASP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     233.04|      73|     207|     133|     212|       7
---------------------------------------------------------------------------
  133-  212 (109.95/82.06)	AGGSTGSQRPQGTPTPTRRVdsYSSSVAIYAAFISAITGSlnLQLIRRSSAI...PLGSRTLFTIIERDYY.ETSgivNDDPSS
  344-  420 (123.10/72.79)	AGETLRLNEDNSSTLPLKRV..LWPAVYCFRRTKSASPGS..SQWIENACPVvgdPLDFAENWRVVEKPKQdETS...PKPPSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.72|      15|      16|    1253|    1268|       8
---------------------------------------------------------------------------
 1253- 1268 (23.73/18.85)	IW.VATKDI.LDRIQArW
 1270- 1286 (18.99/ 9.27)	VFvVSTGPVdQDEVDA.W
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.69|      17|      23|    1040|    1060|       9
---------------------------------------------------------------------------
 1040- 1060 (21.84/23.02)	LCPwDVGS..LETAhflPAMQSL
 1063- 1081 (25.86/11.76)	ICE.DLGTalLKSS...PSNDSL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12450 with Med13 domain of Kingdom Fungi
Unable to open file!