<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12449
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPITGVFFIPSNPNASTAFATITERLHSSLADEPIPVGRWALEHKLMRDTPSCLPTSASQRPAQPRYMQFLSLTYFPNHGFIYTSPPPGKVSHAHHGAGSPGTVAPGASSPASPTPVPQQTATPTQAPAPNSQDHSSMVMTTVPLPACSTLFQHFVYACQPFWCHRHTVTVPGGVVYDVGDFRVRIGDVRQTQPAARVRGTIVEIEWKGPSLVTSIASLFSQSKKAFGGPRTSDLPDDDGDSGIDMAFPEGLEEADIDGEYAATATLIREFWARLGIQGAREAILVQDLGREAKEQLRKLKQLGDQKARQPSTNVTGSGQQDEDPDPEAGVDVARQFMEIFRFNR |
| Length | 345 |
| Position | Head |
| Organism | Aspergillus oryzae (Yellow koji mold) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.383 |
| Instability index | 49.79 |
| Isoelectric point | 5.93 |
| Molecular weight | 37431.60 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12449
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.23| 21| 71| 81| 104| 2
---------------------------------------------------------------------------
81- 104 (32.29/22.93) FIYTSPPpgKVSHaHHGAGSPGTV
155- 175 (44.94/21.19) FVYACQP..FWCH.RHTVTVPGGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 123.77| 36| 114| 185| 220| 3
---------------------------------------------------------------------------
185- 220 (60.92/35.72) RIGDVRQTQPAARVRGTIVEIEWKGPSLVTSIASLF
302- 337 (62.85/37.07) QLGDQKARQPSTNVTGSGQQDEDPDPEAGVDVARQF
---------------------------------------------------------------------------
|