<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12440

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSDRASSASFRLGPPSPSSPAAGSLKSNHPSYTSTEHTPQTPTSPPLMSVSAQNYASNFTSSQTSPGQATSQPANLSSPPSSVPMSTQASQQPTVGTTNSFPTPASSVNGHFTGATPVDDSEQTEKSFGPEMGATSTADMNAPIQQTEHRRTDHDRQSEGPSAQTGVRDFGITGDQNMLNHGDAMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATGPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPGMAGGLRQMTMWPEEEWQNQKVFGKEIKVADMDSALHNLQMRAMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAATPSNGVRVPSQANGTPNAAEPERSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGISKKKRKKDHVSKISTPLPERGGSYGVGMYGIGAR
Length457
PositionHead
OrganismAspergillus oryzae (Yellow koji mold)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati.
Aromaticity0.06
Grand average of hydropathy-0.891
Instability index49.13
Isoelectric point6.40
Molecular weight48903.08
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12440
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      74.09|      18|      20|      17|      34|       1
---------------------------------------------------------------------------
   17-   34 (33.02/19.52)	PSSPAAGSLKS....NHPS.YTS
   39-   61 (23.20/11.08)	PQTPTSPPLMSvsaqNYASnFTS
   80-   93 (17.86/ 6.48)	PSSVPMSTQAS....QQP.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.94|      16|     131|     126|     146|       2
---------------------------------------------------------------------------
  100-  123 (22.87/ 6.39)	SFptpassvnGHFTGATPVDDS....EQ
  127-  146 (25.07/21.97)	SF........GPEMGATSTADMnapiQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     280.44|      83|     137|     184|     267|       3
---------------------------------------------------------------------------
  184-  267 (135.03/73.88)	AMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATgPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKG
  324-  406 (145.41/76.03)	AMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAAT.PSNGVRVPSQANGTPNAAEPERSRPSRGRKRHYDDNSFVGYGEG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12440 with Med19 domain of Kingdom Fungi
Unable to open file!