Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRASSASFRLGPPSPSSPAAGSLKSNHPSYTSTEHTPQTPTSPPLMSVSAQNYASNFTSSQTSPGQATSQPANLSSPPSSVPMSTQASQQPTVGTTNSFPTPASSVNGHFTGATPVDDSEQTEKSFGPEMGATSTADMNAPIQQTEHRRTDHDRQSEGPSAQTGVRDFGITGDQNMLNHGDAMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATGPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPGMAGGLRQMTMWPEEEWQNQKVFGKEIKVADMDSALHNLQMRAMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAATPSNGVRVPSQANGTPNAAEPERSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGISKKKRKKDHVSKISTPLPERGGSYGVGMYGIGAR |
Length | 457 |
Position | Head |
Organism | Aspergillus oryzae (Yellow koji mold) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.891 |
Instability index | 49.13 |
Isoelectric point | 6.40 |
Molecular weight | 48903.08 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP12440 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 74.09| 18| 20| 17| 34| 1 --------------------------------------------------------------------------- 17- 34 (33.02/19.52) PSSPAAGSLKS....NHPS.YTS 39- 61 (23.20/11.08) PQTPTSPPLMSvsaqNYASnFTS 80- 93 (17.86/ 6.48) PSSVPMSTQAS....QQP..... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.94| 16| 131| 126| 146| 2 --------------------------------------------------------------------------- 100- 123 (22.87/ 6.39) SFptpassvnGHFTGATPVDDS....EQ 127- 146 (25.07/21.97) SF........GPEMGATSTADMnapiQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 280.44| 83| 137| 184| 267| 3 --------------------------------------------------------------------------- 184- 267 (135.03/73.88) AMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATgPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKG 324- 406 (145.41/76.03) AMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAAT.PSNGVRVPSQANGTPNAAEPERSRPSRGRKRHYDDNSFVGYGEG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKKRKKDHVSKIST 2) YGVGMYGIGAR 3) YWEDIL | 425 447 337 | 438 457 342 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab