<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12435
| Description |
Uncharacterized protein |
| Sequence | MNALSTTTSTKHASVSNTTATTAHETLVARVDSQIDSLLSGMRLVIAAAGGSSTTTTANAAANATPSSSSVTDQHTFLAAQESLVAEAATANMARSVEQLLGLTTELKQTLILNDFAALNQQILSRHRTLTNQTALCQTNLAEMRSDLIKVHQQLVDSLYGSV |
| Length | 163 |
| Position | Head |
| Organism | Batrachochytrium salamandrivorans |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Chytridiomycetes> Rhizophydiales>
Rhizophydiales incertae sedis> Batrachochytrium.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.002 |
| Instability index | 30.93 |
| Isoelectric point | 5.89 |
| Molecular weight | 17114.95 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12435
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.34| 26| 26| 85| 110| 1
---------------------------------------------------------------------------
60- 83 (22.08/10.65) ......AAANATPSSSSVTDQHTFLaaQES
85- 110 (38.19/23.97) VAE..AATANMARSVEQLLGLTTEL..KQT
112- 139 (35.07/21.39) ILNdfAALNQQILSRHRTLTNQTAL..CQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.45| 11| 33| 13| 23| 3
---------------------------------------------------------------------------
13- 23 (17.91/ 8.09) ASVSNTTATTA
48- 58 (18.54/ 8.60) AAGGSSTTTTA
---------------------------------------------------------------------------
|