<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12434
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MPHTTSLPAAVKEQSLLSQADEIYPAYVTLISELFGALDVVASIKPKASSRLAISAEAGSSVTQMASTPLEVLEKLKALDIRLQQYRHSIESHQQLVRKVQLVKEDLDSRNKSVLLLVKRLHHAQEGLDAVLADAHYKQSLMHKANQGSIDFNELLAYAQRVSKHTMSPVNPNTWVVEPPIPQDNHMRMSLLFRQDQLFNKKEVKCTMVSPSFPSFCFLNRGGSFCFNRRKTGLVLGSYWLIEFLMHGYDAAPYCIWNGMGLDILLWNDTIGLKAEVGLVSDTTMELDLLAHEPLIHIGHDEAHAEALLDLDFE |
| Length | 314 |
| Position | Middle |
| Organism | Batrachochytrium salamandrivorans |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Chytridiomycetes> Rhizophydiales>
Rhizophydiales incertae sedis> Batrachochytrium.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.101 |
| Instability index | 50.42 |
| Isoelectric point | 5.95 |
| Molecular weight | 35215.10 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12434
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.09| 13| 19| 90| 108| 3
---------------------------------------------------------------------------
96- 108 (20.56/21.13) LVRKVQLVKEDLD
117- 129 (22.53/ 7.64) LVKRLHHAQEGLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.88| 12| 15| 43| 54| 5
---------------------------------------------------------------------------
43- 54 (19.02/14.61) SIKPKASSRLAI
61- 72 (19.86/15.57) SVTQMASTPLEV
---------------------------------------------------------------------------
|