<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12423
Description |
Uncharacterized protein |
Sequence | MESDKKQPSVCKTPAQAVQLDDSQSVAQIHGVEKRLLNALSLASQAILLLDQPNKDPEDIKEAFEEKCVILGNVITEIQSGLRTLLFKFASTGVLDAAGQQLEYNITTSGVEKDLEIITNGISLLRSELAHHQPSPSSS |
Length | 139 |
Position | Head |
Organism | Batrachochytrium salamandrivorans |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Chytridiomycetes> Rhizophydiales>
Rhizophydiales incertae sedis> Batrachochytrium.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.210 |
Instability index | 59.64 |
Isoelectric point | 4.86 |
Molecular weight | 15053.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12423
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.07| 22| 79| 31| 53| 1
---------------------------------------------------------------------------
31- 53 (32.52/26.08) GVEKRL...LNALSLAsQAILLLDQP
110- 134 (34.56/22.76) GVEKDLeiiTNGISLL.RSELAHHQP
---------------------------------------------------------------------------
|