<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12413
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MSASYWSSSQRRFWTYTKPELAQIRRSLEDEIKELVQKYPLPDRRLLHIYFCSQLNKLVRRLKLSQQAVATAQVYIRRVYTKIEIRRTNPNLVIVTALYLACKMEESPQHIRMILGEARQAWQDIILPDTSKLGECEFSLISEMNSQLIIHHPYRSLLDLQTSFKLTHEEYAQAEYVINDHYLTDLPLLHPPHVIAIAAMVIAVTLGPTQAGINLLTAANMQSAMSGLSQAGSSGASPVKMQHLMNWLADSSVDIEAVADCVQEMVSLYEVWEQYNEKICKDQINRFIKARGLEK |
| Length | 295 |
| Position | Kinase |
| Organism | Diplodia seriata |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Diplodia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.173 |
| Instability index | 56.21 |
| Isoelectric point | 7.12 |
| Molecular weight | 33807.69 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12413
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.41| 19| 19| 207| 225| 1
---------------------------------------------------------------------------
207- 225 (33.53/21.79) GPTQAGINLLTAANMQSAM
227- 245 (32.89/21.26) GLSQAGSSGASPVKMQHLM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.98| 18| 23| 157| 178| 2
---------------------------------------------------------------------------
157- 178 (25.11/25.29) LLDLqtsfKLTHEEY..AQAEYVI
183- 202 (26.87/15.81) LTDL....PLLHPPHviAIAAMVI
---------------------------------------------------------------------------
|