<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12411
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSAHAHAPGSRAPPEEIRSLDLLAQRIQHLNGALEVLKNTQLAHIWDNTPPAPWPTVAHQSNIINGRLSALLEAFAANRTLLGQAHPFPLPTFPGRSHENMATQLTRKKMVPWVEDWIADGVKLAVGDEDDAAAALARGEGDARAAKLVGDGGMTGEQIEELWDWAGPAGGEIGREVLTAEDEDEDGEDEDEDDEEEEGGAMEGVEGAGAEKKTETVPPIRPMMPLDDILKFVSTGVAP |
| Length | 239 |
| Position | Head |
| Organism | Diplodia seriata |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Diplodia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.475 |
| Instability index | 48.69 |
| Isoelectric point | 4.40 |
| Molecular weight | 25626.14 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12411
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.46| 23| 56| 124| 161| 1
---------------------------------------------------------------------------
124- 147 (33.39/38.37) LAVGDED............DAAAALARGEGdARAAK
178- 212 (31.07/ 7.43) LTAEDEDedgedededdeeEEGGAMEGVEG.AGAEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.63| 12| 115| 41| 52| 3
---------------------------------------------------------------------------
41- 52 (24.68/13.04) QLAHIWDNTPPA
158- 169 (24.95/13.26) QIEELWDWAGPA
---------------------------------------------------------------------------
|