| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDHNHFEQQLKDTIQCLHNIMVQVTSYDAATTTTSSTSTTSSPLPSTTSPAPLSSSASSSRDVLAAELTALSRSLRAVHRAAAAPPAGGAAAARSLPSVPPELVQYVDNGRNPDVYTREFVELVRRGNQLMRGKRRAFAAFRDVLAAEIAAAMPELRDDAARVLAATASSSSAPGGGPL |
| Length | 179 |
| Position | Middle |
| Organism | Rosellinia necatrix (White root-rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Xylariaceae> Rosellinia. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.202 |
| Instability index | 62.76 |
| Isoelectric point | 7.98 |
| Molecular weight | 18743.76 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP12410
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 125.02| 35| 80| 61| 96| 1
---------------------------------------------------------------------------
29- 59 (37.57/10.27) ....AATTTTSSTSTT..SSPLPST.....TSPAPLSSSASS
61- 95 (58.87/23.34) RDVLAAELTALSRSLR..AVHRAAA.....APPAGGAAAARS
142- 177 (28.57/ 7.86) RDVLAAEIAAAMPELRddAARVLAAtasssSAPGGG......
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AAAAR 2) AAELTALSRSLRAVHRAAAAPP | 90 65 | 94 86 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab