| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASSDVSMAQDTPSPEPEPKYGGYTRFEIELEFVQSLANPFYLNHLASLKLLSDPAFIAYLAYLQYWRQPPYIKYLNYPGPTIKHLELLQEERFRQEIISPDLVQALAAEGVKASVEWHKDE |
| Length | 122 |
| Position | Middle |
| Organism | Rosellinia necatrix (White root-rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Xylariaceae> Rosellinia. |
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.368 |
| Instability index | 59.58 |
| Isoelectric point | 4.89 |
| Molecular weight | 14063.77 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP12409 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) PEPKYGGYTRFEI 2) PYIKYLNYP | 17 71 | 29 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab