<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12406

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGVVMMDGGASHFQSTNHDRSNGPRTNGAQGSPNGLVNHVGNQSALGTNTMPNGNTDGSADAGSSRSPAPVTSRMNDLPDEIQHITQGFIPLRLLLCRLAQQTQNELGDEIMALAKMPLPSSVMNGNGVGADASVDDNSPENLNKKVRLLNFVQEKHGEWVKALIIVNWSRKAEPVSKLIDLMHHINKTRAVYQASLDYMINIRRDLTYARIPNPDLRTALQVLSTGQAPWMPELNYIQPPQITPEEQLRWIENLNTLLSIRLNLDEHENIPEQFQNFEIQSGRITFKVPREFEVDLTIADEDPEKQFWFIDFRFAFQPAPSELTDRLREVLELKVNEALQKDGLPGCYKFLHEFVLTHKITEYYRQAMDLSRGRWVDMLAVERLRRAMAIHYWSGRRSDGPQSYLIMGVSSGKDSSSIAGQRNSSRLTLRWFRDGTEVKDVQFPLDEESISTEALLNRVIGKHTEHILRGFHNVMKSQGRYVEHEASLGLNIVDGRPEESALTMQLSHEQCLTIKVAPITGMLLAMPPSKGNFDLQSQLNKEVRRPVTDQVALLERFRCSFVEDELNRRGKSRGWSVCNRPPVKPEEARQFLGIRGTYQLIWLKRRGLPDGWYIMVGQSLNGDQWWLTEIIERSDSNKIMAHARLPLSPSIPRYSDKFFAELTFFSSAMMSQIGILGAMHKERMKYAVQDRINPLLPPNMKVPSIHVRLSEILGRHHPHVSKNISSWAFDTVEINLKTIENRLPQSMDPAAGPGSRGSNEGIAPLASEQHRYNIVVDARVKVADPSRFGPLRGNVERDVAFNERLGVFAFSIEAAVGSSILDTLAHRLQALSRLAGSIDAIRQSPQDVQCEEITLNNVKFSYTDRARSTNAEAQQNSHRWTASLDLQTENIKLILDPGNPQLRAAEQFDKLINSAEGFKGVPWFLSTTLPIHRALSSVEHAWEALAMTNQCRVNISVISLDCYTIQYTLNLAKDVSRCLTLFVKLQSYNAVPQWHVYREETGPQRQPDDEFQKILQKVWLSGERPWRRLGPSVAADATDGIEALVKATDEAIRPLAVKSPSISKQPQPKMAAQKNVGQTKSVAASKPRPPQQTGLAGKVVISLDD
Length1107
PositionTail
OrganismRosellinia necatrix (White root-rot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Xylariaceae> Rosellinia.
Aromaticity0.07
Grand average of hydropathy-0.431
Instability index54.31
Isoelectric point7.97
Molecular weight124434.06
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12406
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.21|      14|      17|     223|     236|       2
---------------------------------------------------------------------------
  223-  236 (26.09/16.15)	QVLSTGQAPWMPEL
  243-  256 (25.12/15.26)	QITPEEQLRWIENL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     125.06|      41|      52|     414|     457|       3
---------------------------------------------------------------------------
  414-  457 (60.94/47.98)	GKDSSSI.AGQRNSSRLTLRWFRD....GTEVKDVQfPldEESISTEAL
  463-  508 (64.13/39.35)	GKHTEHIlRGFHNVMKSQGRYVEHeaslGLNIVDGR.P..EESALTMQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.18|      23|      54|     327|     350|       4
---------------------------------------------------------------------------
  327-  350 (35.73/26.94)	DRLREVLELKVNEALQKDGlPGCY
  384-  406 (43.44/28.43)	ERLRRAMAIHYWSGRRSDG.PQSY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     135.60|      41|      59|     974|    1015|       5
---------------------------------------------------------------------------
  974- 1015 (69.42/53.33)	AKDVSRCLTLFVKlQSYNAVPQWHVYREETGPQRQPDDEFQK
 1036- 1076 (66.18/45.81)	AADATDGIEALVK.ATDEAIRPLAVKSPSISKQPQPKMAAQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.57|      10|      34|     568|     577|       6
---------------------------------------------------------------------------
  568-  577 (21.03/ 9.60)	LNRRGKSRGW
  605-  614 (21.54/ 9.99)	LKRRGLPDGW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.17|      12|      16|      29|      42|      13
---------------------------------------------------------------------------
   29-   42 (19.56/15.26)	GAQGSPNGlvNHVG
   48-   59 (24.61/13.01)	GTNTMPNG..NTDG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12406 with Med14 domain of Kingdom Fungi

Unable to open file!