<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12405
Description |
cyclin-dependent kinase 8 |
Sequence | MDYEFKIKTSNERTKVEDLFDYEGCKVGRGTYGHVYKARRKDNSDTRDYALKQIEGTGLSMSACREIALLRELKHPNVINLISVFLSHNDRKVWLLFDYAEHDLWHIIKFHRAAKANKKPVMVPKGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGEGIERGRVKIADMGFARLFNNPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFSVMGFPLEKDWEDIRKMPEHPTLLKDFNER |
Length | 286 |
Position | Kinase |
Organism | Diaphorina citri (Asian citrus psyllid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.376 |
Instability index | 33.75 |
Isoelectric point | 8.52 |
Molecular weight | 33416.27 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12405
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.22| 11| 76| 11| 22| 1
---------------------------------------------------------------------------
11- 22 (17.58/14.82) NERtKVEDLFDY
89- 99 (23.64/14.79) NDR.KVWLLFDY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.70| 25| 39| 102| 129| 4
---------------------------------------------------------------------------
102- 129 (42.02/36.77) HDLWhiiKFHRAAKANKKPVM...VPKGMVK
143- 170 (40.67/26.71) HSNW...VLHRDLKPANILVMgegIERGRVK
---------------------------------------------------------------------------
|